PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100167230032
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family G2-like
Protein Properties Length: 240aa    MW: 27082.7 Da    PI: 8.1711
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100167230032genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.18.5e-332376255
                       G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                                  prlrWtp+LH++Fv+av++LGG++kAtPk +l+lm+v gLt++hvkSHLQ+YR+
  Ote100167230032|100167230032 23 PRLRWTPDLHHCFVHAVDRLGGQHKATPKLVLQLMDVRGLTISHVKSHLQMYRS 76
                                  8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.9241979IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-311978IPR009057Homeodomain-like
SuperFamilySSF466892.87E-152179IPR009057Homeodomain-like
TIGRFAMsTIGR015577.0E-242377IPR006447Myb domain, plants
PfamPF002491.8E-82475IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MSSNSHAYAR NNGVRQYIRS KVPRLRWTPD LHHCFVHAVD RLGGQHKATP KLVLQLMDVR  60
GLTISHVKSH LQMYRSMKNN VPQQDEENNE VLFLSPTTKR GRVEKMSEEV ECRRRRICGA  120
VTNPYSSNDD YMQSKVGIXX XXXXXXCRVH HIQLNSQNPS ATADALLLQS DFFKVQKDRC  180
KMEQFSGNEE ADDGCELSLC LPLQKSTVSC TTEISEAVSS SSSHQFHGIN LDLSIALCGA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011070508.14e-84PREDICTED: putative Myb family transcription factor At1g14600
TrEMBLD7SMG83e-59D7SMG8_VITVI; Putative uncharacterized protein
STRINGVIT_01s0137g00050.t017e-59(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA54332238